Structure of PDB 4av1 Chain B Binding Site BS01

Receptor Information
>4av1 Chain B (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDR
WYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4av1 The Zinc-Finger Domains of Parp1 Cooperate to Recognise DNA Strand-Breaks
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K119 S120 R122 T124 R138 L151
Binding residue
(residue number reindexed from 1)		K13 S14 R16 T18 R32 L45
Enzymatic activity
Enzyme Commision number 2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4av1, PDBe:4av1, PDBj:4av1
PDBsum4av1
PubMed22683995
UniProtP09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]