Structure of PDB 4apo Chain B Binding Site BS01

Receptor Information

>4apo Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSP
EWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKR
GKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDK
ARFR

Ligand information

>4apo Chain D (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AEDDVE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4apo Structure of the Tpr Domain of Aip: Lack of Client Protein Interaction with the C-Terminal Alpha-7 Helix of the Tpr Domain of Aip is Sufficient for Pituitary Adenoma Predisposition.
Resolution	1.895 Å
Binding residue (original residue number in PDB)	H183 N187 Y190 R191 Y202 P232 N236 K266 F269
Binding residue (residue number reindexed from 1)	H12 N16 Y19 R20 Y31 P61 N65 K95 F98

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:4apo, PDBe:4apo, PDBj:4apo
PDBsum	4apo
PubMed	23300914
UniProt	O00170\|AIP_HUMAN AH receptor-interacting protein (Gene Name=AIP)

[Back to BioLiP]