Structure of PDB 4aon Chain B Binding Site BS01

Receptor Information
>4aon Chain B (length=98) Species: 511693 (Escherichia coli BL21) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIP
Ligand information
>4aon Chain A (length=27) Species: 511693 (Escherichia coli BL21) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGSMIRTMLQGKLHRVKVTHADLHYEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aon Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
Resolution1.5 Å
Binding residue
(original residue number in PDB)		A36 G37 I69 S70 V71 N72 G73 A76 H77 S80 V81 G82 D83 I84 V85 I86 I87 A88 S89 F90 V91 T92 M93 P94 D95 A98 W101 P103 N104 V105 A106 F108 N112
Binding residue
(residue number reindexed from 1)		A12 G13 I45 S46 V47 N48 G49 A52 H53 S56 V57 G58 D59 I60 V61 I62 I63 A64 S65 F66 V67 T68 M69 P70 D71 A74 W77 P79 N80 V81 A82 F84 N88
Enzymatic activity
Catalytic site (original residue number in PDB) Y58
Catalytic site (residue number reindexed from 1) Y33
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aon, PDBe:4aon, PDBj:4aon
PDBsum4aon
PubMed
UniProtP0A790|PAND_ECOLI Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]