Structure of PDB 4aij Chain B Binding Site BS01

Receptor Information
>4aij Chain B (length=142) Species: 633 (Yersinia pseudotuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQ
LAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIE
QVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aij Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		T32 P61 S62 R85
Binding residue
(residue number reindexed from 1)		T31 P60 S61 R84
Binding affinityPDBbind-CN: Kd=46nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4aij, PDBe:4aij, PDBj:4aij
PDBsum4aij
PubMed22936808
UniProtB1JJ73|SLYA_YERPY Transcriptional regulator SlyA (Gene Name=slyA)

[Back to BioLiP]