Structure of PDB 4aa6 Chain B Binding Site BS01

Receptor Information
>4aa6 Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHDYMCPATNQCTIDKN
RRKSCQACRLRKCYEVGMMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aa6 The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E203 G204 A207 R211 R234 K235 Q238 R241
Binding residue
(residue number reindexed from 1)		E22 G23 A26 R30 R52 K53 Q56 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aa6, PDBe:4aa6, PDBj:4aa6
PDBsum4aa6
PubMed7735836
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]