Structure of PDB 4a5x Chain B Binding Site BS01

Receptor Information
>4a5x Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKR
CNLREKISKYMDRAENIKKYLDQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a5x Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		Q39 E40 D43 L46 L49 K50 R58 R62 E63 S66 M69 A72 E73 K76
Binding residue
(residue number reindexed from 1)		Q31 E32 D35 L38 L41 K42 R50 R54 E55 S58 M61 A64 E65 K68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4a5x, PDBe:4a5x, PDBj:4a5x
PDBsum4a5x
PubMed23045692
UniProtQ8WV92|MITD1_HUMAN MIT domain-containing protein 1 (Gene Name=MITD1)

[Back to BioLiP]