Structure of PDB 4a2x Chain B Binding Site BS01

Receptor Information
>4a2x Chain B (length=120) Species: 8839 (Anas platyrhynchos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKNLLCGKCKAYACSTDDIRIIKDSHHIVLGEAFKERYTTKPHKKPMQFD
GFEKKSKMYCRNNNCQHDWGITVKYLTFDNLPVIKIKSFVMESQMDFQKW
KSINSSLKNFDVEEMSNLYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a2x Structural basis for the activation of innate immune pattern-recognition receptor RIG-I by viral RNA.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		H832 F855 I877 V889 K891 I892
Binding residue
(residue number reindexed from 1)		H26 F49 I71 V83 K85 I86
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links