Structure of PDB 4a1v Chain B Binding Site BS01

Receptor Information
>4a1v Chain B (length=188) Species: 31647 (Hepatitis C virus subtype 1b) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVVIVGRIILSGPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVST
ATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAP
PGARSLTPCSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGP
LLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
Ligand information
>4a1v Chain D (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DELVYLLDGPGYDPIHS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1v High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
V-9 S7 Q9 S37 A39 T40 Q41 S42 H57 R109 L135 K136 G137 S139 F154 A156 A157 V158 C159
Binding residue
(residue number reindexed from 1)
V6 S19 Q21 S49 A51 T52 Q53 S54 H69 R117 L143 K144 G145 S147 F162 A164 A165 V166 C167
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H69 D93 G145 S147
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4a1v, PDBe:4a1v, PDBj:4a1v
PDBsum4a1v
PubMed22965230
UniProtP26662|POLG_HCVJA Genome polyprotein

[Back to BioLiP]