Structure of PDB 4a1t Chain B Binding Site BS01

Receptor Information
>4a1t Chain B (length=194) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVVIVGRIILSGKGGPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQV
VSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGW
QAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYL
KGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Ligand information
>4a1t Chain D (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRLVYLLDGPGYDPIHCD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1t High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		V-9 S7 Q9 S37 A39 T40 Q41 S42 F43 H57 R109 K136 G137 S139 F154 R155 A156 A157 V158 C159
Binding residue
(residue number reindexed from 1)		V6 S22 Q24 S52 A54 T55 Q56 S57 F58 H72 R124 K151 G152 S154 F169 R170 A171 A172 V173 C174
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H72 D96 G152 S154
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4a1t, PDBe:4a1t, PDBj:4a1t
PDBsum4a1t
PubMed22965230
UniProtP26662|POLG_HCVJA Genome polyprotein

[Back to BioLiP]