Structure of PDB 4a1s Chain B Binding Site BS01

Receptor Information
>4a1s Chain B (length=342) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSMCLELALEGERLCNAGDCRAGVAFFQAAIQAGTEDLRTLSAIYSQLG
NAYFYLGDYNKAMQYHKHDLTLAKSMNDRLGEAKSSGNLGNTLKVMGRFD
EAAICCERHLTLARQLGDRLSEGRALYNLGNVYHAKGKHLGQRNPGKFGD
DVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAI
EHHQERLRIAREFGDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALA
VELGEREVEAQSCYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIGEA
RACWSLGNAHSAIGGHERALKYAEQHLQLAAAAAAAAAAAAA
Ligand information
>4a1s Chain E (length=28) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEPVASWMSEQRWAGEPEVMCTLQHKSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1s Inscuteable and Numa Proteins Bind Competitively to Leu-Gly- Asn Repeat-Enriched Protein (Lgn) During Asymmetric Cell Divisions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L48 E51 R78 S85 Q86 N89 F92 Y93 D107 G119 N126 N129 R162 Y165 N166 K176 Q180 F186 R219 N223 N226 Y229 L230 R244 R258 R259 N263 F270 S303 N306 L310 W342 N346
Binding residue
(residue number reindexed from 1)		L10 E13 R40 S47 Q48 N51 F54 Y55 D69 G81 N88 N91 R124 Y127 N128 K138 Q142 F148 R181 N185 N188 Y191 L192 R206 R220 R221 N225 F232 S265 N268 L272 W304 N308
Enzymatic activity
Enzyme Commision number ?
External links