Structure of PDB 3zzz Chain B Binding Site BS01

Receptor Information
>3zzz Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYA
DPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPD
LPSGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zzz Crystallographic Analysis of Polypyrimidine Tract-Binding Protein-Raver1 Interactions Involved in Regulation of Alternative Splicing.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		N245 I246 Y247
Binding residue
(residue number reindexed from 1)		N66 I67 Y68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3zzz, PDBe:3zzz, PDBj:3zzz
PDBsum3zzz
PubMed22153504
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]