Structure of PDB 3zvy Chain B Binding Site BS01

Receptor Information
>3zvy Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPL
SSVPSEDEWYCPECRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zvy The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
P327 Q330 L331 M332 D334 D337 E355
Binding residue
(residue number reindexed from 1)
P28 Q31 L32 M33 D35 D38 E56
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3zvy, PDBe:3zvy, PDBj:3zvy
PDBsum3zvy
PubMed22096602
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]