Structure of PDB 3zrj Chain B Binding Site BS01

Receptor Information
>3zrj Chain B (length=165) Species: 345076 (Vibrio cholerae V52) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHTDPIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEHYLD
VLLDNPLSDVRLVLKQAGLEVDQVKQAIASTYSREQVLDTYPAFSPLLVE
LLQEAWLLSSTELEQAELRSGAIFLAALTRADRYLSFKLISLFEGINREN
LKKHFAMILSDSAET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zrj Molecular Basis for the Unique Role of the Aaa+ Chaperone Clpv in Type Vi Protein Secretion.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		P7 K18 E22 A25 S26 Y84 P85 A86 F87
Binding residue
(residue number reindexed from 1)		P14 K25 E29 A32 S33 Y91 P92 A93 F94
External links