Structure of PDB 3zqi Chain B Binding Site BS01

Receptor Information
>3zqi Chain B (length=201) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLD
ALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHLGT
RPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHQV
AKEERETPTTDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQLTA
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zqi An Exclusive Alpha/Beta Code Directs Allostery in Tetr-Peptide Complexes.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		E147 H151 E156 P161 D164 M166 L170 R171 I174 E175 F177
Binding residue
(residue number reindexed from 1)		E144 H148 E153 P158 D161 M163 L167 R168 I171 E172 F174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zqi, PDBe:3zqi, PDBj:3zqi
PDBsum3zqi
PubMed22178479
UniProtP04483|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR);
P0ACT4|TETR4_ECOLX Tetracycline repressor protein class D (Gene Name=tetR)

[Back to BioLiP]