Structure of PDB 3zmp Chain B Binding Site BS01

Receptor Information
>3zmp Chain B (length=266) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKL
HQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVM
LNRVMKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLT
TQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVH
SSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTA
DQLRFSYLAVIEGAKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zmp Development of Accessible Peptidic Tool Compounds to Study the Phosphatase Ptp1B in Intact Cells.
Resolution2.619 Å
Binding residue
(original residue number in PDB)		R24 N44 Y46 R47 D48 F182 S215 S216 A217 I219 G220 R221 Q262
Binding residue
(residue number reindexed from 1)		R15 N35 Y37 R38 D39 F168 S201 S202 A203 I205 G206 R207 Q248
Enzymatic activity
Catalytic site (original residue number in PDB) D181 S215 R221 S222 Q262
Catalytic site (residue number reindexed from 1) D167 S201 R207 S208 Q248
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zmp, PDBe:3zmp, PDBj:3zmp
PDBsum3zmp
PubMed24387659
UniProtP18031|PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 (Gene Name=PTPN1)

[Back to BioLiP]