Structure of PDB 3zbw Chain B Binding Site BS01

Receptor Information

>3zbw Chain B (length=121) Species: 10090 (Mus musculus)

QDNYRYIKFLTQHYDAKPTGRDYRYCESMMKKRKLTSPCKEVNTFIHDTK
NNIKAICGENGNPYGVNFRISNSRFQVTTCTHKGGSPRPPCQYNAFKDFR
YIVIACEDGWPVHFDESFISP

Ligand information

• Ligand ID: SO4
• InChI: InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2
• InChIKey: QAOWNCQODCNURD-UHFFFAOYSA-L
• SMILES:
  OpenEye OEToolkits 1.5.0: [O-]S(=O)(=O)[O-]
  CACTVS 3.341: [O-][S]([O-])(=O)=O
  ACDLabs 10.04: [O-]S([O-])(=O)=O
• Formula: O4 S
• Name: SULFATE ION
• DrugBank: DB14546
• PDB chain: 3zbw Chain B Residue 1122

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3zbw Crystal Structures of Murine Angiogenin-2 and -3 - Probing 'Structure - Function' Relationships Amongst Angiogenin Homologues.
• Resolution: 1.801 Å
• Binding residue (original residue number in PDB): H13 H113 F114
• Binding residue (residue number reindexed from 1): H13 H113 F114
• Annotation score: 3

Enzymatic activity

• Catalytic site (original residue number in PDB): H13 K40 H113 F114 D115
• Catalytic site (residue number reindexed from 1): H13 K40 H113 F114 D115
• Enzyme Commision number: 3.1.27.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001525 angiogenesis
• GO:0017148 negative regulation of translation
• GO:0030154 cell differentiation

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:3zbw, PDBe:3zbw, PDBj:3zbw
• PDBsum: 3zbw
• PubMed: 23170778
• UniProt: P97802|ANG3_MOUSE Angiogenin-3 (Gene Name=Ang3)