Structure of PDB 3x1l Chain B Binding Site BS01

Receptor Information
>3x1l Chain B (length=319) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKG
LKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGK
LILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSR
EKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRV
AFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKI
DDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYI
KLGKLKKLGYGLALGGIWE
Ligand information
>3x1l Chain I (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaaguuguaguaugcgguccuugcggcu
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3x1l Crystal structure of the CRISPR-Cas RNA silencing Cmr complex bound to a target analog.
Resolution2.096 Å
Binding residue
(original residue number in PDB)		R15 S17 F20 A22 Q36 T37 G40 A41 R43 T44 F47 Y48 V55 I147 G148 I149 K150 L151 K156 L163 Y164 T196 G198 G199 E200 S201 S267 G268 W269 M271 P276 K277
Binding residue
(residue number reindexed from 1)		R15 S17 F20 A22 Q36 T37 G40 A41 R43 T44 F47 Y48 V55 I144 G145 I146 K147 L148 K153 L160 Y161 T193 G195 G196 E197 S198 S264 G265 W266 M268 P273 K274
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x1l, PDBe:3x1l, PDBj:3x1l
PDBsum3x1l
PubMed25921071
UniProtQ8U1S7|CMR3_PYRFU CRISPR system Cmr subunit Cmr3 (Gene Name=cmr3)

[Back to BioLiP]