Structure of PDB 3wzi Chain B Binding Site BS01

Receptor Information
>3wzi Chain B (length=106) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASMKFAVIDRKNFTLIHFEIEKPIKPEILKEIEIPSVDTRKGVVISGRGP
IWLHCFLAHKYHHTPFVAVYDPRLGAVVVQSHSELREGDVIDVVVEEILK
GGVRHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wzi Crystal structures of CRISPR-associated Csx3 reveal a manganese-dependent deadenylation exoribonuclease.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
P21 I22 G45 R46 G47 P48 I49 D69 P70
Binding residue
(residue number reindexed from 1)
P23 I24 G47 R48 G49 P50 I51 D71 P72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3wzi, PDBe:3wzi, PDBj:3wzi
PDBsum3wzi
PubMed26106927
UniProtO28415|Y1864_ARCFU Uncharacterized protein AF_1864 (Gene Name=AF_1864)

[Back to BioLiP]