Structure of PDB 3wut Chain B Binding Site BS01

Receptor Information
>3wut Chain B (length=44) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wut Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution2.301 Å
Binding residue
(original residue number in PDB)
L178 N181 E192 V195
Binding residue
(residue number reindexed from 1)
L11 N14 E25 V28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3wut, PDBe:3wut, PDBj:3wut
PDBsum3wut
PubMed26392564
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]