Structure of PDB 3w8j Chain B Binding Site BS01

Receptor Information
>3w8j Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHAQRLTPEWKKA
ATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGR
TGEAIVDAALSALRQLVKDRLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3w8j Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
Resolution2.1 Å
Binding residue
(original residue number in PDB)		C55 H57 Q96 G97 F98 R118
Binding residue
(residue number reindexed from 1)		C37 H39 Q78 G79 F80 R100
Enzymatic activity
Enzyme Commision number 5.3.4.1: protein disulfide-isomerase.
Gene Ontology
Molecular Function
GO:0003756 protein disulfide isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:3w8j, PDBe:3w8j, PDBj:3w8j
PDBsum3w8j
PubMed23949117
UniProtQ15084|PDIA6_HUMAN Protein disulfide-isomerase A6 (Gene Name=PDIA6)

[Back to BioLiP]