Structure of PDB 3vyy Chain B Binding Site BS01

Receptor Information
>3vyy Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN
STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vyy Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9).
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y9 G13
Binding residue
(residue number reindexed from 1)		Y9 G13
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3vyy, PDBe:3vyy, PDBj:3vyy
PDBsum3vyy
PubMed23361462
UniProtQ08211|DHX9_HUMAN ATP-dependent RNA helicase A (Gene Name=DHX9)

[Back to BioLiP]