Structure of PDB 3vw4 Chain B Binding Site BS01

Receptor Information
>3vw4 Chain B (length=120) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPL
SPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSAR
SLKPWEALGISRATYYRKLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vw4 Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H174 Y177
Binding residue
(residue number reindexed from 1)		H4 Y7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:3vw4, PDBe:3vw4, PDBj:3vw4
PDBsum3vw4
PubMed25538245
UniProtQ06B24

[Back to BioLiP]