Structure of PDB 3vdy Chain B Binding Site BS01

Receptor Information
>3vdy Chain B (length=97) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVN
CTLWRKTAENTALYCQKGSLVGVSGRIQTRNVYVTEVLADTVRFMDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vdy Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R10 T12 A32 N34 Y48
Binding residue
(residue number reindexed from 1)
R10 T12 A32 N34 Y48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006310 DNA recombination
GO:0030420 establishment of competence for transformation
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3vdy, PDBe:3vdy, PDBj:3vdy
PDBsum3vdy
PubMed22373918
UniProtC0SPB6|SSBB_BACSU Single-stranded DNA-binding protein B (Gene Name=ssbB)

[Back to BioLiP]