Structure of PDB 3vd0 Chain B Binding Site BS01

Receptor Information
>3vd0 Chain B (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPI
QIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPA
SHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSS
CVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYRE
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vd0 Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		S261 R268 R293 C295 A296 R300
Binding residue
(residue number reindexed from 1)		S150 R157 R182 C184 A185 R189
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vd0, PDBe:3vd0, PDBj:3vd0
PDBsum3vd0
PubMed22474346
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]