Structure of PDB 3v62 Chain B Binding Site BS01

Receptor Information
>3v62 Chain B (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL
EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII
LLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRD
LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD
QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL
APKFN
Ligand information
>3v62 Chain C (length=21) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SQMDIFSQLSRAKKGEIIVID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3v62 Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R44 V45 L47 G127 I128 E232 A233 P234 F249 A251 P252 K253 F254
Binding residue
(residue number reindexed from 1)		R44 V45 L47 G127 I128 E232 A233 P234 F249 A251 P252 K253 F254
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
GO:0042802 identical protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0000710 meiotic mismatch repair
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006273 lagging strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0007064 mitotic sister chromatid cohesion
GO:0019985 translesion synthesis
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0035753 maintenance of DNA trinucleotide repeats
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0051054 positive regulation of DNA metabolic process
GO:0070987 error-free translesion synthesis
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005657 replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3v62, PDBe:3v62, PDBj:3v62
PDBsum3v62
PubMed22382979
UniProtP15873|PCNA_YEAST Proliferating cell nuclear antigen (Gene Name=POL30)

[Back to BioLiP]