Structure of PDB 3uw5 Chain B Binding Site BS01

Receptor Information

>3uw5 Chain B (length=92) Species: 9606 (Homo sapiens)

GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFC
YGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLT

Ligand information

>3uw5 Chain Y (length=3)

AGP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3uw5 Discovery of a Potent Small-Molecule Antagonist of Inhibitor of Apoptosis (IAP) Proteins and Clinical Candidate for the Treatment of Cancer (GDC-0152).
• Resolution: 1.71 Å
• Binding residue (original residue number in PDB): L131 Q132 S133 W134 D138 E143 W147
• Binding residue (residue number reindexed from 1): L54 Q55 S56 W57 D61 E66 W70

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:3uw5, PDBe:3uw5, PDBj:3uw5
• PDBsum: 3uw5
• PubMed: 22413863
• UniProt: P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP);
  Q96CA5|BIRC7_HUMAN Baculoviral IAP repeat-containing protein 7 (Gene Name=BIRC7)