Structure of PDB 3us2 Chain B Binding Site BS01

Receptor Information

>3us2 Chain B (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DYPGPHSFDVSFQTWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRA
MPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVE
DPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTL
ETRDGQVLGRRCFEARICACPGRDRKADEDSI

Ligand information

>3us2 Chain F (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacatgtttaacatgttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3us2 Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	R304 C306 A307 R311
Binding residue (residue number reindexed from 1)	R166 C168 A169 R173

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3us2, PDBe:3us2, PDBj:3us2
PDBsum	3us2
PubMed	22247550
UniProt	Q9H3D4\|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]