Structure of PDB 3us0 Chain B Binding Site BS01

Receptor Information

>3us0 Chain B (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MASPSNTDYPGPHSFDVSFQSATWTYSTELKKLYCQIAKTCPIQIKVMTP
PPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVE
GNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNR
RPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRK

Ligand information

>3us0 Chain E (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacatgtttataaacatgttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3us0 Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	S150 R279
Binding residue (residue number reindexed from 1)	S21 R150

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3us0, PDBe:3us0, PDBj:3us0
PDBsum	3us0
PubMed	22247550
UniProt	Q9H3D4\|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]