Structure of PDB 3ulp Chain B Binding Site BS01

Receptor Information
>3ulp Chain B (length=114) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRTNELKS
KTDWHRIVVYDQNIVDLIDKYLRKGRRVYVQGSLHTRKWHTNDQPKQITE
IILSYNKGDLIFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ulp Plasmodium falciparum SSB Tetramer Wraps Single-Stranded DNA with Similar Topology but Opposite Polarity to E. coli SSB.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
M77 N78 E79 R90 G92 K98 N101 S110 A112 W117 K128 W131 H132 R133 Y137 K151 R164 W166 Q177 I178 S184
Binding residue
(residue number reindexed from 1)
M1 N2 E3 R14 G16 K22 N25 S34 A36 W41 K51 W54 H55 R56 Y60 K74 R87 W89 Q97 I98 S104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3ulp, PDBe:3ulp, PDBj:3ulp
PDBsum3ulp
PubMed22543099
UniProtQ8I415

[Back to BioLiP]