Structure of PDB 3ulg Chain B Binding Site BS01

Receptor Information

>3ulg Chain B (length=62) Species: 5759 (Entamoeba histolytica)

ALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEI
DQNEFAKFYGSI

Ligand information

• Ligand ID: BA
• InChI: InChI=1S/Ba/q+2
• InChIKey: XDFCIPNJCBUZJN-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ba++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ba+2]
• Formula: Ba
• Name: BARIUM ION
• PDB chain: 3ulg Chain B Residue 135

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3ulg Flexibility of EF-hand motifs: Structural and thermodynamic studies of Calcium Binding Protein- 1 from Entamoeba histolytica with Pb2+, Ba2+, and Sr2+
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): D10 N12 D14 A16 E21
• Binding residue (residue number reindexed from 1): D7 N9 D11 A13 E18
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0051015 actin filament binding

Biological Process

• GO:0006909 phagocytosis
• GO:0032231 regulation of actin filament bundle assembly
• GO:0045859 regulation of protein kinase activity
• GO:0050766 positive regulation of phagocytosis
• GO:1905303 positive regulation of macropinocytosis

Cellular Component

• GO:0001891 phagocytic cup
• GO:0005737 cytoplasm
• GO:0031143 pseudopodium
• GO:0042995 cell projection

External links

• PDB: RCSB:3ulg, PDBe:3ulg, PDBj:3ulg
• PDBsum: 3ulg
• PubMed: 22906057
• UniProt: P38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)