Structure of PDB 3ufd Chain B Binding Site BS01

Receptor Information
>3ufd Chain B (length=77) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ufd The structural basis of differential DNA sequence recognition by restriction-modification controller proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L33 D34 T36 Y37 R46 N47 L48 T49 S52
Binding residue
(residue number reindexed from 1)		L32 D33 T35 Y36 R45 N46 L47 T48 S51
Binding affinityPDBbind-CN: Kd=0.61nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ufd, PDBe:3ufd, PDBj:3ufd
PDBsum3ufd
PubMed22941636
UniProtQ8GGH0

[Back to BioLiP]