Structure of PDB 3u0t Chain B Binding Site BS01

Receptor Information
>3u0t Chain B (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCKASGYYTEAYYIHWVRQAPGQGLEWMGR
IDPATGNTKYAPRLQDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCASLY
SLPVYWGQGTTVTVSSASTKGPSVFPLAPCSSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSQTYTCNVDHKPSN
TKVDKTVER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u0t Structural Basis of C-terminal beta-Amyloid Peptide Binding by the Antibody Ponezumab for the Treatment of Alzheimer's Disease
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A31 Y32 R50 Y96 S97 L98
Binding residue
(residue number reindexed from 1)		A31 Y32 R50 Y100 S101 L102
External links