Structure of PDB 3ts2 Chain B Binding Site BS01

Receptor Information
>3ts2 Chain B (length=137) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEG
FRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNC
GGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Ligand information
>3ts2 Chain U (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggucuaugauaccaccccggag
<<<<<..........>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ts2 Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		R138 C139 Y140 H148 A149 P156 Q157 K159 K160 C161 H162 F163 M170 V171 K177
Binding residue
(residue number reindexed from 1)		R96 C97 Y98 H106 A107 P114 Q115 K117 K118 C119 H120 F121 M128 V129 K135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3ts2, PDBe:3ts2, PDBj:3ts2
PDBsum3ts2
PubMed22078496
UniProtQ8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)

[Back to BioLiP]