Structure of PDB 3thk Chain B Binding Site BS01

Receptor Information
>3thk Chain B (length=58) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPA
AYVKKLDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3thk High-Resolution Crystal Structure of Spectrin SH3 Domain Fused with a Proline-Rich Peptide.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
Y12 D39 W40 Y56
Binding residue
(residue number reindexed from 1)
Y8 D35 W36 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3thk, PDBe:3thk, PDBj:3thk
PDBsum3thk
PubMed22066535
UniProtP16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 (Gene Name=Sptan1)

[Back to BioLiP]