Structure of PDB 3tdi Chain B Binding Site BS01

Receptor Information
>3tdi Chain B (length=200) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGY
KKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYN
YAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDE
GKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQ
Ligand information
>3tdi Chain C (length=13) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLKLRQLQKKKQK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tdi N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D89 I90 D91 V94 L104 E105 T109 L110 L121 E122 L173 I174 D176 Y190
Binding residue
(residue number reindexed from 1)
D21 I22 D23 V26 L36 E37 T41 L42 L53 E54 L105 I106 D108 Y122
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tdi, PDBe:3tdi, PDBj:3tdi
PDBsum3tdi
PubMed21940857
UniProtQ12395|DCN1_YEAST Defective in cullin neddylation protein 1 (Gene Name=DCN1)

[Back to BioLiP]