Structure of PDB 3t70 Chain B Binding Site BS01

Receptor Information
>3t70 Chain B (length=137) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHLKIVCLSDEVREMYKNHDSGLDLFIVKDEVLKPKSTTFVKLGIKAIAL
QYKSNYYYKCNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAA
LDNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t70 Design, synthesis, and evaluation of 5'-diphenyl nucleoside analogues as inhibitors of the Plasmodium falciparum dUTPase.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K96 T97 P98
Binding residue
(residue number reindexed from 1)		K77 T78 P79
Enzymatic activity
Catalytic site (original residue number in PDB) S27 R91 S93 L99 D109
Catalytic site (residue number reindexed from 1) S21 R72 S74 L80 D90
Enzyme Commision number 3.6.1.23: dUTP diphosphatase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004170 dUTP diphosphatase activity
GO:0016787 hydrolase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006226 dUMP biosynthetic process
GO:0006260 DNA replication
GO:0006399 tRNA metabolic process
GO:0009117 nucleotide metabolic process
GO:0046081 dUTP catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3t70, PDBe:3t70, PDBj:3t70
PDBsum3t70
PubMed22049550
UniProtQ8II92

[Back to BioLiP]