Structure of PDB 3t6r Chain B Binding Site BS01

Receptor Information
>3t6r Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLD
PPLSSVPSEDEWYCPECR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t6r UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
Resolution1.95 Å
Binding residue
(original residue number in PDB)
P327 Q330 L331 M332 C333 D334 D337 E355
Binding residue
(residue number reindexed from 1)
P31 Q34 L35 M36 C37 D38 D41 E59
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3t6r, PDBe:3t6r, PDBj:3t6r
PDBsum3t6r
PubMed22100450
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]