Structure of PDB 3swc Chain B Binding Site BS01

Receptor Information

>3swc Chain B (length=261) Species: 9606 (Homo sapiens)

VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRN
ITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFEC
NHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEY
VGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP
NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFS
CRCGSPKCRHS

Ligand information

>3swc Chain Q (length=8) Species: 10090 (Mus musculus)

ARKVGRPG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3swc MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
• Resolution: 2.332 Å
• Binding residue (original residue number in PDB): Y1124 D1131 A1134 D1135 D1140 S1141 Y1142 L1143 F1144 D1145 D1147 V1153 F1209 Y1211 R1214 F1215 I1218 K1219
• Binding residue (residue number reindexed from 1): Y150 D157 A160 D161 D166 S167 Y168 L169 F170 D171 D173 V179 F235 Y237 R240 F241 I244 K245

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1124 Y1211
• Catalytic site (residue number reindexed from 1): Y150 Y237
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046974 histone H3K9 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3swc, PDBe:3swc, PDBj:3swc
• PDBsum: 3swc
• PubMed: 22086334
• UniProt: Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 (Gene Name=EHMT1)