Structure of PDB 3sou Chain B Binding Site BS01

Receptor Information
>3sou Chain B (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPP
LSSVPSEDEWYCPECRNDA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sou PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
Resolution1.8001 Å
Binding residue
(original residue number in PDB)
P340 D341 Q343 M345 C346 D347 D350 E368
Binding residue
(residue number reindexed from 1)
P29 D30 Q32 M34 C35 D36 D39 E57
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3sou, PDBe:3sou, PDBj:3sou
PDBsum3sou
PubMed21777816
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]