Structure of PDB 3siv Chain B Binding Site BS01

Receptor Information
>3siv Chain B (length=237) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD
YIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEEL
ERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGV
AGGLTNLSKMPACNIMLLGAQVLPHTGYIYHSDIVQSLPPDLRRKAARLV
AAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ
Ligand information
>3siv Chain C (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uacuguccaaugagcgcauagugagggcagua
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3siv Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
Resolution3.304 Å
Binding residue
(original residue number in PDB)		V234 M244 C247 N248 L251 H270
Binding residue
(residue number reindexed from 1)		V150 M160 C163 N164 L167 H175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3siv, PDBe:3siv, PDBj:3siv
PDBsum3siv
PubMed21784869
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]