Structure of PDB 3rz2 Chain B Binding Site BS01

Receptor Information
>3rz2 Chain B (length=152) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLV
EKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGL
GRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL
RF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rz2 PRL-1 protein promotes ERK1/2 and RhoA protein activation through a non-canonical interaction with the Src homology 3 domain of p115 Rho GTPase-activating protein.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T55 T56 W68
Binding residue
(residue number reindexed from 1)		T47 T48 W60
Enzymatic activity
Catalytic site (original residue number in PDB) P25
Catalytic site (residue number reindexed from 1) P17
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation
GO:0030335 positive regulation of cell migration
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3rz2, PDBe:3rz2, PDBj:3rz2
PDBsum3rz2
PubMed22009749
UniProtQ78EG7|TP4A1_RAT Protein tyrosine phosphatase type IVA 1 (Gene Name=Ptp4a1)

[Back to BioLiP]