Structure of PDB 3rto Chain B Binding Site BS01

Receptor Information
>3rto Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rto Acoustically Mounted Microcrystals Yield High-Resolution X-ray Structures.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 K29
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3rto, PDBe:3rto, PDBj:3rto
PDBsum3rto
PubMed21542590
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]