Structure of PDB 3rn5 Chain B Binding Site BS01

Receptor Information

>3rn5 Chain B (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTL
LKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKA
GETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGV
RNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAK

Ligand information

>3rn5 Chain K (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccatcaaagagagaaagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rn5 Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K309 R311 K335 I337
Binding residue (residue number reindexed from 1)	K163 R165 K189 I191

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:3rn5, PDBe:3rn5, PDBj:3rn5
PDBsum	3rn5
PubMed	22483801
UniProt	O14862\|AIM2_HUMAN Interferon-inducible protein AIM2 (Gene Name=AIM2)

[Back to BioLiP]