Structure of PDB 3r6g Chain B Binding Site BS01

Receptor Information
>3r6g Chain B (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVA
DMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r6g Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
Resolution2.07 Å
Binding residue
(original residue number in PDB)
A376 M377 R378 N379 T380 W385 G419 Y420 F426
Binding residue
(residue number reindexed from 1)
A22 M23 R24 N25 T26 W31 G65 Y66 F72
Enzymatic activity
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3r6g, PDBe:3r6g, PDBj:3r6g
PDBsum3r6g
PubMed21828056
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]