Structure of PDB 3r2d Chain B Binding Site BS01

Receptor Information
>3r2d Chain B (length=138) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKK
LVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKE
PGRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r2d Structural basis for RNA recognition by NusB and NusE in the initiation of transcription antitermination.
Resolution2.199 Å
Binding residue
(original residue number in PDB)		K36 K39 N40 K113
Binding residue
(residue number reindexed from 1)		K37 K40 N41 K114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r2d, PDBe:3r2d, PDBj:3r2d
PDBsum3r2d
PubMed21652641
UniProtO66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]