Structure of PDB 3qsy Chain B Binding Site BS01

Receptor Information
>3qsy Chain B (length=89) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAP
RYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV
Ligand information
>3qsy Chain D (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca
...<<<<....<<.........>>.....<<<.......>>>.......<
<<<<.......>>>>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qsy Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
Resolution3.2 Å
Binding residue
(original residue number in PDB)		A224 R226
Binding residue
(residue number reindexed from 1)		A49 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity

View graph for
Molecular Function
External links
PDB RCSB:3qsy, PDBe:3qsy, PDBj:3qsy
PDBsum3qsy
PubMed23291527
UniProtQ97Z79|IF2A_SACS2 Translation initiation factor 2 subunit alpha (Gene Name=eif2a)

[Back to BioLiP]