Structure of PDB 3qoq Chain B Binding Site BS01

Receptor Information

>3qoq Chain B (length=44) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGA

Ligand information

>3qoq Chain E (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actggcaaaacgccggca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qoq The Transcription Factor AmrZ Utilizes Multiple DNA Binding Modes to Recognize Activator and Repressor Sequences of Pseudomonas aeruginosa Virulence Genes.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	F19 V20 R22
Binding residue (residue number reindexed from 1)	F4 V5 R7

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3qoq, PDBe:3qoq, PDBj:3qoq
PDBsum	3qoq
PubMed	22511872
UniProt	G3XCY4\|AMRZ_PSEAE Transcription factor AmrZ (Gene Name=amrZ)

[Back to BioLiP]