Structure of PDB 3qlc Chain B Binding Site BS01

Receptor Information
>3qlc Chain B (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDIS
RDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRRELSTIMDEN
NQWYCYICHPEPLLDLVTACNSVYENL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qlc ATRX ADD domain links an atypical histone methylation recognition mechanism to human mental-retardation syndrome
Resolution2.5 Å
Binding residue
(original residue number in PDB)
D212 M216 D217 E218 G226 G227 N228 L229 C231 D233 E259
Binding residue
(residue number reindexed from 1)
D52 M56 D57 E58 G66 G67 N68 L69 C71 D73 E99
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
External links
PDB RCSB:3qlc, PDBe:3qlc, PDBj:3qlc
PDBsum3qlc
PubMed21666679
UniProtP46100|ATRX_HUMAN Transcriptional regulator ATRX (Gene Name=ATRX)

[Back to BioLiP]