Structure of PDB 3qjj Chain B Binding Site BS01

Receptor Information
>3qjj Chain B (length=240) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGF
WTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPE
FKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDL
YPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSY
IRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qjj Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
Resolution2.8049 Å
Binding residue
(original residue number in PDB)		R2 F18 N19 Y20 R54 V57 R58 R60 I62 P64 I68 Y78 S127 R145 W147 D148 K187 K189 T191 R192 Y199 R201 L204 M205 Y220 K236 L237
Binding residue
(residue number reindexed from 1)		R3 F19 N20 Y21 R55 V58 R59 R61 I63 P65 I69 Y79 S128 R146 W148 D149 K188 K190 T192 R193 Y200 R202 L205 M206 Y221 K237 L238
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qjj, PDBe:3qjj, PDBj:3qjj
PDBsum3qjj
PubMed
UniProtO58088|CAS6L_PYRHO Putative CRISPR-associated endoribonuclease-like protein Cas6nc (Gene Name=cas6nc)

[Back to BioLiP]