Structure of PDB 3qgl Chain B Binding Site BS01

Receptor Information
>3qgl Chain B (length=96) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGA
ADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qgl Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		Y51 F53 N54 V55 R56 G57 V59 S80 H112
Binding residue
(residue number reindexed from 1)		Y14 F16 N17 V18 R19 G20 V22 S43 H75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qgl, PDBe:3qgl, PDBj:3qgl
PDBsum3qgl
PubMed21422294
UniProtQ8K4V4|SNX27_RAT Sorting nexin-27 (Gene Name=Snx27)

[Back to BioLiP]